PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011083785.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family Dof
Protein Properties Length: 251aa    MW: 26842.1 Da    PI: 8.3925
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011083785.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.95.1e-3949107361
          zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                      ++l+cprCdstntkfCyynny+l+qPr+fCk+CrryWt+GGalrnvP+Ggg+rk  +s
  XP_011083785.1  49 PEQLPCPRCDSTNTKFCYYNNYNLTQPRHFCKSCRRYWTRGGALRNVPIGGGTRKASSS 107
                     6789***************************************************8776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-2647110IPR003851Zinc finger, Dof-type
PfamPF027014.6E-3351106IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.23652106IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105490IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MDSLLNTSLS PELITKHHFT PIPQPNTPEV VSDSTHPRLS RYPSRAPEPE QLPCPRCDST  60
NTKFCYYNNY NLTQPRHFCK SCRRYWTRGG ALRNVPIGGG TRKASSSNKR HRIATTPTPP  120
AATTTTSEGQ TRRPDRVASN PGSGLCSGSI QDAPAAKPVT LTPWWSTAST VMGVECGLLP  180
LNGYGLGLAS GLGYGHGVLD WPMEQGAMAV AVESPGCNTW QVGGGGEGGV AEDDYFSWPD  240
LAISTPGKAL K
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ0475392e-56KJ047539.1 Sesamum indicum clone TilSSR_18740 microsatellite Sesame_18740 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011083785.10.0PREDICTED: dof zinc finger protein DOF1.6
TrEMBLA0A022RYJ74e-48A0A022RYJ7_ERYGU; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45322241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.19e-36DOF zinc finger protein 1